xua.ro

Comenzi USA Shopping America
Comenzi pe toate site-urile americane de imbracaminte ,piese auto, electronice, absolut orice produs.Comenzi ebay,comenzi amazon,comenzi eastbay,comenzi victoria secret,c

xua.ro Description

Sponsored links
Xua.ro is currently hosted in: Romania, The Server IP is : 89.42.216.153 Xua.ro is ranked 12370941 in the world. The Google Pagerank is /10. Last Updated 2013-04-01 04:08:47

Website Info

IP:89.42.216.153
Country :Romania
Server Location:
Latitude :46
Longitude :25
Post Code :
ISP :Jump Network Services S.R.L.
Organization :ROMARG SRL
Alexa rank: 12370941
Links:2
Google indexed:
Pagerank:

Server Location Map

Alexa Traffic Graph Analysis

Social Popularity For Xua.ro

Google+ Twitter Tweet Facebook Likes FB Shares FB Comments

Magestic Backlinks

Xua.ro DNS Records :

Host Type IP/Target Class TTL Other
xua.ro TSOA IN 14400 mname:ns1.wdp-gazduire.ro
rname:hostmaster.intranet.romarg.com
serial:2012041100
refresh:86400
retry:7200
expire:3600000
minimum-ttl:86400
xua.ro TTXT IN 14400
xua.ro TMX mx03.whmpanels.com IN 3600 retry:30
xua.ro TMX mx01.whmpanels.com IN 3600 retry:10
xua.ro TMX mx02.whmpanels.com IN 3600 retry:20
xua.ro TA 89.42.216.153 IN 14399
xua.ro TNS ns4.wdp-gazduire.ro IN 14400
xua.ro TNS ns1.wdp-gazduire.ro IN 14400
xua.ro TNS ns3.wdp-gazduire.ro IN 14400
xua.ro TNS ns2.wdp-gazduire.ro IN 14400

Xua.ro Whois


Website Keywords

comenzi ebay
comenzi eastbay
comenzi amazon
comenzi victoria secret
comenzi din america
shopping america
shopping usa
comenzi piese auto americane
piese auto masini ameri

Recent Domain Check

daiko-look.jp
65ku.com
zplee.com
houtenkozijnen.eu
makelaardij.p.v.rijswickkneepkens.makelaarstarieve
artecolis.galeon.com
weinrouten.blogspot.com
krampconsulting.com
wayforward.com.au
nth-theme-creator.fyxm.net
familyenrichment.cc
spookyphotogroup.newsvine.com
insulationdirect2u.co.uk
mamin-dom.ru
nwlober.com
yaowe544.zh114.cn

Recent Search Keywords

portfolio cases for graphic designers
call center architectural designs
phpbb3 styles
dabandd2 videos mp3
infringement notice
toribash sidekick tutorial
java ee 6 webcam
vacation fantasy watch
deploy adobe reader using mdt 2012
ibps in
minima stretch header
download keygen ccproxy
my prize bond
closing remarks samle speech js prom
upbasiceducation parishad bakshi ka talab merit
nepali puti lado ko chikai video

2012 All Copyright © Privacy Policy | Terms Of Service | Contact us | distst.com